Protein Info for Dshi_0680 in Dinoroseobacter shibae DFL-12

Annotation: phosphoribosylaminoimidazole carboxylase, ATPase subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to PURK_BRUME: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 100% identity to dsh:Dshi_0680)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
inosine-5'-phosphate biosynthesis I (6/6 steps found)
inosine-5'-phosphate biosynthesis II (5/5 steps found)
inosine-5'-phosphate biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQE0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Dshi_0680 phosphoribosylaminoimidazole carboxylase, ATPase subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTEPLAPGAVIGMLGGGQLGRMLSMAAARLGFRCHIFEPGAAPPAGQVAEAVTTAGYDDL
DALRRFAEVVDVITYEFENIPTAALDVLEALRPIHPGRRALAVSQDRLTEKEFLRGLGLQ
TAPFAPVDDAAGLEAALAAIGTPAILKTRRLGYDGKGQTRLTAPGDAAEALAAMAGAPAI
LEGFVEFSHEVSVIAARGQDGAVACFDPGENVHRDGILATTTVPARLSHAQRTDAVLLAG
RILNALDYVGVMGVELFVTRGGLIVNEIAPRVHNSGHWTQTGCVIDQFEQHIRAVAGWPL
GDGQRHADVVMENLIGSDMDRVPELAAARDVALHLYGKAETRAGRKMGHANRIMRPG