Protein Info for Dshi_0667 in Dinoroseobacter shibae DFL-12

Annotation: heavy metal translocating P-type ATPase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 transmembrane" amino acids 121 to 142 (22 residues), see Phobius details amino acids 153 to 173 (21 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 366 to 387 (22 residues), see Phobius details amino acids 395 to 421 (27 residues), see Phobius details amino acids 686 to 703 (18 residues), see Phobius details amino acids 708 to 726 (19 residues), see Phobius details PF00403: HMA" amino acids 40 to 99 (60 residues), 32.4 bits, see alignment 1.5e-11 TIGR01511: copper-translocating P-type ATPase" amino acids 169 to 729 (561 residues), 486.6 bits, see alignment E=2.3e-149 TIGR01525: heavy metal translocating P-type ATPase" amino acids 187 to 728 (542 residues), 487.4 bits, see alignment E=1.4e-149 TIGR01512: cadmium-translocating P-type ATPase" amino acids 212 to 728 (517 residues), 348.1 bits, see alignment E=1.7e-107 TIGR01494: HAD ATPase, P-type, family IC" amino acids 222 to 464 (243 residues), 106.6 bits, see alignment E=2.2e-34 amino acids 552 to 711 (160 residues), 112.3 bits, see alignment E=4e-36 PF00122: E1-E2_ATPase" amino acids 252 to 348 (97 residues), 82 bits, see alignment E=3.6e-27 PF00702: Hydrolase" amino acids 447 to 640 (194 residues), 97.1 bits, see alignment E=2.7e-31

Best Hits

KEGG orthology group: K01533, Cu2+-exporting ATPase [EC: 3.6.3.4] (inferred from 100% identity to dsh:Dshi_0667)

Predicted SEED Role

"Type cbb3 cytochrome oxidase biogenesis protein CcoI; Copper-translocating P-type ATPase (EC 3.6.3.4)" (EC 3.6.3.4)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.4

Use Curated BLAST to search for 3.6.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQC7 at UniProt or InterPro

Protein Sequence (729 amino acids)

>Dshi_0667 heavy metal translocating P-type ATPase (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDLSAHSLGPSANSACPACAAAPLAEQLSKRPVRGGIVLSLPGIHCASCISGVERLLDA
TPGVVGARVNLTRKRVLIDAEEGITPEALAQLLTDKGFEAYELDPGQLGNAEADRPARDL
LMRLAVSGFAMMNIMLLSVAVWSGAEAATRDMFHWISAAIAIPTIGFCAQPFFSNSWRAL
KAGRLNMDVPISLAILLAVGMSLYETANSGAHAYFDAAVSLTFFLLAGRYLDFRTRASAR
SAAQELAALEVPRAIKLVGGTEVKTVVADLAVGDLIRVTPGSRVPADGLVVDGVSELDRS
LLTGESLPVHAAPDTPVSAGEMNLTGVLTLRVTAAGQDSSLHRMAELVAVAENARSKYTS
LADKAAGLYAPGVHILAALTGLGWMLYSMDLRLSLNIASAVLIITCPCALGLAVPAVVTA
ASGRLFRRGLLIKSGTALERLAEVDEVVFDKTGTLTLGQPILENADRIAARDLAVARALA
QGSAHPLARAIAATDAGGASAEVTELREVPGYGVEGRWQDQPVRLGRADWVGAAQGDVTA
TWLRIGQAAPVAFEFKDALRPGAAEAVAALQARGLKVSLLSGDAPGAVARVARELGITDY
RAECRPEEKAAHVTARGEAGYKVLMVGDGLNDTAALAAAHASVSPASALDAARVASDIVL
LGQDLSPLADMLQTARKSTKLIRENFTISTVYNVVAVPLAIAGLATPLIAALAMSVSSIT
VSLNALRVR