Protein Info for Dshi_0649 in Dinoroseobacter shibae DFL-12

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 8 to 110 (103 residues), 80.1 bits, see alignment E=5.9e-27 PF02575: YbaB_DNA_bd" amino acids 15 to 105 (91 residues), 109.9 bits, see alignment E=2.8e-36

Best Hits

Swiss-Prot: 57% identical to Y4104_MAGSA: Nucleoid-associated protein amb4104 (amb4104) from Magnetospirillum magneticum (strain AMB-1 / ATCC 700264)

KEGG orthology group: K09747, hypothetical protein (inferred from 100% identity to dsh:Dshi_0649)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LQA9 at UniProt or InterPro

Protein Sequence (114 amino acids)

>Dshi_0649 hypothetical protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MLKGLGNLGDMAKVMKQAQEMQAKMAEMQENLKTITVTGESGAGLVKATATAKGELTGLD
IDPSIFNPEEKEVAEDLILAAIKDAQAKALDKGREEMAKVTEGLNLPEGMKLPF