Protein Info for Dshi_0609 in Dinoroseobacter shibae DFL-12
Annotation: transcriptional regulator, GntR family with aminotransferase domain (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00375, GntR family transcriptional regulator / MocR family aminotransferase (inferred from 100% identity to dsh:Dshi_0609)Predicted SEED Role
"Transcriptional regulator, GntR family domain / Aspartate aminotransferase (EC 2.6.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.6.1.1)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (17/18 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
- aspartate superpathway (21/25 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- TCA cycle VIII (Chlamydia) (6/6 steps found)
- superpathway of L-threonine biosynthesis (6/6 steps found)
- superpathway of L-methionine biosynthesis (transsulfuration) (8/9 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- malate/L-aspartate shuttle pathway (2/2 steps found)
- L-tyrosine degradation I (4/5 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-aspartate biosynthesis (1/1 steps found)
- L-aspartate degradation I (1/1 steps found)
- (R)-cysteate degradation (2/3 steps found)
- sulfolactate degradation III (2/3 steps found)
- superpathway of sulfolactate degradation (4/6 steps found)
- L-glutamate degradation II (1/2 steps found)
- L-tryptophan degradation IV (via indole-3-lactate) (1/2 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- trans-4-hydroxy-L-proline degradation I (3/5 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
- L-asparagine degradation III (mammalian) (1/3 steps found)
- L-phenylalanine degradation II (anaerobic) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- indole-3-acetate biosynthesis VI (bacteria) (1/3 steps found)
- L-tryptophan degradation VIII (to tryptophol) (1/4 steps found)
- superpathway of L-aspartate and L-asparagine biosynthesis (1/4 steps found)
- superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tryptophan degradation XIII (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
- C4 photosynthetic carbon assimilation cycle, PEPCK type (7/14 steps found)
- coenzyme M biosynthesis II (1/6 steps found)
- superpathway of chorismate metabolism (38/59 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
- rosmarinic acid biosynthesis I (2/10 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (2/14 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (2/27 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Arginine and proline metabolism
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Carbon fixation in photosynthetic organisms
- Cysteine metabolism
- Glutamate metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.1
Use Curated BLAST to search for 2.6.1.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LPN2 at UniProt or InterPro
Protein Sequence (514 amino acids)
>Dshi_0609 transcriptional regulator, GntR family with aminotransferase domain (RefSeq) (Dinoroseobacter shibae DFL-12) MARKTSGALLPGLDLDPSADTPLATQLYDSLRYHISEGTLAAGVRMPSTRTLSTELGMSR TTVAGAYDQLKSEGYLTSEEKSGTFVADLLPEKLAWSTQLHYARPDDLRQLEPDLAARFD DNLPKQRERTSRTLPFNPGIPAVFEFPSQTWIRIMRPILSQLAPNGIARCPAEGSIELRE EVSRYLSGSRGVTCSPEQVLIISGTRQALTLIMMALANQGDTGWVEDPGYPGISRVYDLF RVGTVPVPVDAHGLVVEEAIERAPHSKFAYVTPARQAPLGHTMSIRRRIELLNWAYASEA FILEDDYDGEYRFGGHPAPSLQSLDPEGRVFYFGTFSKTVLPSLGLGYLVVPTRYVDVFR NLLDAITRPPSLATQLTMAEFMASGLFEAHIRKMRTLYLSRQNALSAVLRKSMPDLLESK ILNAGLHLIGYLPKGYDDAKVARRAKDLGLLPRPLSDYVHKERLPPGLLIGFSNIKEEAM ARTVRVLRRAIEDCQPETGHAPASRSPTYARGGG