Protein Info for Dshi_0553 in Dinoroseobacter shibae DFL-12

Annotation: short-chain dehydrogenase/reductase SDR (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 12 to 203 (192 residues), 205.6 bits, see alignment E=1.4e-64 PF08659: KR" amino acids 13 to 179 (167 residues), 54.5 bits, see alignment E=3.7e-18 PF01370: Epimerase" amino acids 14 to 118 (105 residues), 21.1 bits, see alignment E=4.7e-08 PF13561: adh_short_C2" amino acids 18 to 253 (236 residues), 209.4 bits, see alignment E=1.5e-65 PF08643: DUF1776" amino acids 100 to 188 (89 residues), 28.7 bits, see alignment E=2.3e-10

Best Hits

Swiss-Prot: 34% identical to UCPA_SALTY: Oxidoreductase UcpA (ucpA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0553)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LPH6 at UniProt or InterPro

Protein Sequence (255 amino acids)

>Dshi_0553 short-chain dehydrogenase/reductase SDR (RefSeq) (Dinoroseobacter shibae DFL-12)
MPWQDRFSLQDKTALVTGASSGIGRAIAEVFADAGADIVGQGRDLDRLTDLGAQIKTTGR
QFAAITGDLADPDQTQNVADRALAAFGKIDILVNSAGIAVTGPVTNYDLDDWQRTLAVNL
TAPFILSKAVMPGMMQRKQGKIINISSQTGVIALKDHAAYATSKGGLNALTKSLMTEAAP
HNVQVNAICPTVVLTEMGKELWSAPERKDPFIARTPLGRFGEPIEIADMALYLASPASDL
VNGAVMMIEGGYSSI