Protein Info for Dshi_0510 in Dinoroseobacter shibae DFL-12

Annotation: conserved hypothetical beta-lactamase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF14863: Alkyl_sulf_dimr" amino acids 50 to 187 (138 residues), 179.4 bits, see alignment E=5e-57 PF14864: Alkyl_sulf_C" amino acids 197 to 318 (122 residues), 132.1 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0510)

Predicted SEED Role

"FIG00805073: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C5ZZD4 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Dshi_0510 conserved hypothetical beta-lactamase (RefSeq) (Dinoroseobacter shibae DFL-12)
MFGTEAEVMFASHHWPRFGNERIQEVLRAQRDLYANLNSQVLHFANQGVTINEIHNVYEP
PESIANNWFNRGYHGSVEHNVRAVINRYLGYWDANPATLIPLSPADSAPLYVEMMGGADA
ILAKGQQLFDTGQYFHAVEILNKLVYAEPDNAAAKDLLADNFEQIGYQQENPGLRNSFLA
GAYELRSPLPTGTATETATPDVIQAMPTGLFLDYIAIKMDSRKAGDTEFTINIVHPDIEE
EYILELSNATLTNIEGYQVETPDLTLTIDRAQLVPVMIGKATIDAQIDAGNAQAEGDRSV
LTQLASLLTDFEMTFEVMPGTEGAAAVPGRYDPEAGPSGVEGNPFQVKTVNAGELPN