Protein Info for Dshi_0496 in Dinoroseobacter shibae DFL-12

Annotation: 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 672 PF12838: Fer4_7" amino acids 285 to 327 (43 residues), 34.6 bits, see alignment 1e-11 PF12837: Fer4_6" amino acids 306 to 327 (22 residues), 26 bits, see alignment (E = 3.2e-09) PF00037: Fer4" amino acids 306 to 327 (22 residues), 24.4 bits, see alignment (E = 1e-08) amino acids 516 to 538 (23 residues), 27.7 bits, see alignment (E = 8.9e-10) amino acids 550 to 570 (21 residues), 21.1 bits, see alignment (E = 1.1e-07) PF12800: Fer4_4" amino acids 311 to 326 (16 residues), 14.3 bits, see alignment (E = 2.2e-05) amino acids 520 to 536 (17 residues), 13.2 bits, see alignment (E = 5.2e-05) amino acids 552 to 566 (15 residues), 12.7 bits, see alignment (E = 7.4e-05) PF13237: Fer4_10" amino acids 516 to 565 (50 residues), 32.4 bits, see alignment 3.6e-11 PF13187: Fer4_9" amino acids 522 to 569 (48 residues), 30.5 bits, see alignment 1.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0496)

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNT6 at UniProt or InterPro

Protein Sequence (672 amino acids)

>Dshi_0496 4Fe-4S ferredoxin iron-sulfur binding domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MIKANANRTILTCTCENTMSPDEGALAKAGCAAGGSVNQLCRANLDNFRAALAKGLPVTV
ACTQEAPLFSEVAADEAPDLPLSFANIRETAGWTAQAATSGPKMAAMIAAAAVAPAPFGV
TTLDSTGVTLILGRDEVAIEAADALSEHLDITVLMQPGSQITPPMQTRFPVLQGRIRTAL
GHLGAFTLTVDDYAAPSPSSREVLKFEAARDGAVSRADLVVDLTGTQPLFAAHDLRPGYL
RADPKNPRAVADLIAKAGQMVGTFDKPVYIDFLADLCAHSRNGITGCTRCLSLCPTGAIT
PNGDSVQIDPAICAGCGQCAAACPTGAAAYALPDVATVAARLRAALKAWHDAGGTTAPVI
LLHDADHGEPLINASGRYGNGLPAHVIPLGLNEITQAGPEVLAAAFAYGAGAVALLGRAK
PLHDVDGLRAGIELVTGVAEAMGHGPVTLIETDDPDALEAALDVLPKSAVHAAPSSFLPP
ADKRGLLVMAFAEMNRAAPKPAQTLPLPQGAPFGSVTVDPEACTLCQACTGVCPTGALLD
NPETPMLRFTESACVQCGLCAATCPETAITLTPQLDFAAWDTPRRILHEEPPFCCTVCGE
AFATRSGIDRVKSRLVDHWMFQGETGAARLKVLSMCEDCRVQEIVNQGFDPHGETIRKVR
TQADYGDGYEDS