Protein Info for Dshi_0453 in Dinoroseobacter shibae DFL-12

Annotation: coenzyme PQQ synthesis D (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 92 TIGR03859: coenzyme PQQ biosynthesis protein PqqD" amino acids 8 to 88 (81 residues), 81.7 bits, see alignment E=1.4e-27 PF05402: PqqD" amino acids 25 to 88 (64 residues), 58.2 bits, see alignment E=4.2e-20

Best Hits

Swiss-Prot: 56% identical to PQQD_RUEPO: PqqA binding protein (pqqD) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K06138, pyrroloquinoline quinone biosynthesis protein D (inferred from 100% identity to dsh:Dshi_0453)

Predicted SEED Role

"Coenzyme PQQ synthesis protein D" in subsystem Coenzyme PQQ synthesis or Pyrroloquinoline Quinone biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNP3 at UniProt or InterPro

Protein Sequence (92 amino acids)

>Dshi_0453 coenzyme PQQ synthesis D (RefSeq) (Dinoroseobacter shibae DFL-12)
MMEAGDIPELPRGVRLHFDKVRETWVLLAPERAVTLDAIGHAILSEIDGTRSFGEITQAL
SDAYNAPRDQIAADSAGFLTALRNRRFLDVRP