Protein Info for Dshi_0452 in Dinoroseobacter shibae DFL-12

Annotation: coenzyme PQQ biosynthesis protein C (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR02111: coenzyme PQQ biosynthesis protein C" amino acids 4 to 241 (238 residues), 386.4 bits, see alignment E=2.4e-120 PF03070: TENA_THI-4" amino acids 10 to 220 (211 residues), 188.1 bits, see alignment E=9.5e-60

Best Hits

Swiss-Prot: 74% identical to PQQC_RHIME: Pyrroloquinoline-quinone synthase (pqqC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K06137, pyrroloquinoline-quinone synthase [EC: 1.3.3.11] (inferred from 100% identity to dsh:Dshi_0452)

MetaCyc: 47% identical to pyrroloquinoline-quinone synthase monomer (Klebsiella pneumoniae)
Pyrroloquinoline-quinone synthase. [EC: 1.3.3.11]

Predicted SEED Role

No annotation

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LNP2 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Dshi_0452 coenzyme PQQ biosynthesis protein C (RefSeq) (Dinoroseobacter shibae DFL-12)
MAQTREQFEARLRQIGAERYHDLHPFHDRLHGGSCTPDQVRAWVINRYYYQHSIPMKDAA
FMSRVESPDLRRAWRSRIEDHDGTAENEGGIRRWLRLAEAVGLEPDYVASCEGVLPATRF
AVDAYVRFVREKTLLEAVAASLTELFAPKIHANRIQGLLKNYAFADDSSLSYFRNRLKEA
PKDVAFGLSWVLDHADTQEKQDAAAKALVFKTDVLWAQLDALSAAYVEPARIPPGAWQPH
EGLARQRKAS