Protein Info for Dshi_0447 in Dinoroseobacter shibae DFL-12

Annotation: transcriptional regulator, Crp/Fnr family (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00027: cNMP_binding" amino acids 52 to 124 (73 residues), 36 bits, see alignment E=5.7e-13 PF13545: HTH_Crp_2" amino acids 169 to 244 (76 residues), 49.8 bits, see alignment E=2.7e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0447)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN51 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Dshi_0447 transcriptional regulator, Crp/Fnr family (RefSeq) (Dinoroseobacter shibae DFL-12)
MTSRARSLLLHGSGSMAPEPRAGLLHGPVGRHVPTLIDLFLRVQPHPQIHTARRGKAVIR
EDDFADHAMLLLEGWVAFSKMLPDGESQIIDILLPGDFALIGAANAPLAAFSVETLSDAR
FINIGPGRVNGPEPEMARLRELMAAEIVRMQSRTSELLLRVGKGSAANRIAYALLEFFVR
LEAVGMTSGTRFAFPMTQHKLGEFTGMSNVHVNRTLRRFEREGIVAYPAPPEIDLCDIDA
LCALAGLDLASFRNEIIARRAP