Protein Info for Dshi_0439 in Dinoroseobacter shibae DFL-12

Annotation: ATP synthase F0, A subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 193 to 216 (24 residues), see Phobius details PF00119: ATP-synt_A" amino acids 23 to 215 (193 residues), 144.1 bits, see alignment E=2.9e-46 TIGR01131: ATP synthase F0, A subunit" amino acids 24 to 217 (194 residues), 116.1 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 56% identical to ATP6_RHOFT: ATP synthase subunit a (atpB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K02108, F-type H+-transporting ATPase subunit a [EC: 3.6.3.14] (inferred from 100% identity to dsh:Dshi_0439)

Predicted SEED Role

"Sodium-transporting ATPase subunit B"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN43 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Dshi_0439 ATP synthase F0, A subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MELTPDTNIVFAPWGFGINATIVNTWIIMAVLTGTAALVTRNLRPDVPPNRWRTTLEVIV
GGIVGQIAEITERRDPRILYFSGTLFLFIVTANLLTVVPGFDTPTASLSTTVALALSVLI
AVPLFGIGSRGLGGYLRTYLEPSVIMLPFNIISEVSRGISLAIRLYGNIMSGAVIAAILL
GVAPFFFPVVMDMLGLLTGVIQAYIFAILATVYISSATAATPKPPKEAP