Protein Info for Dshi_0433 in Dinoroseobacter shibae DFL-12

Annotation: ornithine carbamoyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 TIGR00658: ornithine carbamoyltransferase" amino acids 8 to 331 (324 residues), 420 bits, see alignment E=2.6e-130 PF02729: OTCace_N" amino acids 8 to 148 (141 residues), 153.8 bits, see alignment E=3.5e-49 PF00185: OTCace" amino acids 157 to 329 (173 residues), 174.3 bits, see alignment E=2e-55

Best Hits

Swiss-Prot: 67% identical to OTC_VIBPA: Ornithine carbamoyltransferase (argF) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00611, ornithine carbamoyltransferase [EC: 2.1.3.3] (inferred from 100% identity to dsh:Dshi_0433)

MetaCyc: 63% identical to ornithine carbamoyltransferase ArgI (Escherichia coli K-12 substr. MG1655)
Ornithine carbamoyltransferase. [EC: 2.1.3.3]

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.3.3

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN37 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Dshi_0433 ornithine carbamoyltransferase (RefSeq) (Dinoroseobacter shibae DFL-12)
MAFNLKNRHFLTLRGFTPEEIGFLLKLSADLKSAKYAGTEVPTLRGKEIALIFEKDSTRT
RVGFEVAAHDQGATVTYLGPSGTHLGKKETVKDTARVLGRVYDAIEYRGFGQEIVQELAD
WAGVPVYNGLTDEFHPTQILADFLTMQEHCEKPLREVAYCFMGDAGNNMGDSLLIGGAKM
GMDVRLCAPRSLWPVQSIQDEARAIAEHTGARVTLTEDVDKAVKGVDFVYTDVWVSMGEP
VEKWAERIDLLMPYQVNADVMARTGNPRVRFMHCLPAFHNAETEVGCDIQDKFGLEAMEV
TEEVFESPASIVFDQAENRMHTIKAVLVATLGG