Protein Info for Dshi_0428 in Dinoroseobacter shibae DFL-12

Annotation: Poly-beta-hydroxybutyrate polymerase domain protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 627 PF12551: PHBC_N" amino acids 62 to 101 (40 residues), 61.2 bits, see alignment 1e-20 PF07167: PhaC_N" amino acids 139 to 307 (169 residues), 183.2 bits, see alignment E=5.4e-58 PF00561: Abhydrolase_1" amino acids 281 to 545 (265 residues), 44.5 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 100% identity to dsh:Dshi_0428)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LN32 at UniProt or InterPro

Protein Sequence (627 amino acids)

>Dshi_0428 Poly-beta-hydroxybutyrate polymerase domain protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTKRQTISAPTDDIDPRADHRGGPVAAPVPSTPPARAADGPEVAPELGPLCPAEKPDRHG
LSMLDQATKAHLARLTQGISPFGLTSSFFDWGMHLAASPGKQMQLADKAQRKAAKLAMAA
SRMALGKSGAPCIDPLIYDKRFVAPEWQRWPHNLIYQSFLMTQQWWYNATNDIDGLSRCD
EQVVSFVMRQLLDMMSPANGLWTNPEVLAETTRTFGANLVQGTQNLIEDMERALAGKPPV
GAEDYLPGREVAVTPGKVVHRSHLFELIQYAPQTETVAAEPILIVPAWIMKYYILDLSPH
NSLVRYLVEQGFTVFMISWRNPDAGDRDLGMEDYLAALDTALDEIGAIVPETGVHGVGYC
LGGTLLSVKAALMARDGDDRLKTLSLLATQTDFEDPGELQLFISESQLSYLDHMMWDQGY
LDTKQMAGAFQLLRSRDLIWSRYVHEYLMGRRQPMFDLMAWNADATRMPYRMHSEYLRSM
FLDNQLAQGQYRVGGRPVALSDIRAPVFCVSTTGDHVAPWQSVYKLHLLADTDITFVLTS
GGHNAGIVSEPGHKGRSYQIRTLPDAEHYIPPEDWRAQTQVQDGSWWPEHVAWLRAHGAP
EEGPPPPMGRKGAGDLRDAPGAYVLQP