Protein Info for Dshi_0376 in Dinoroseobacter shibae DFL-12

Annotation: inner-membrane translocator (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 104 (25 residues), see Phobius details amino acids 116 to 136 (21 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details amino acids 295 to 320 (26 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 314 (303 residues), 88.2 bits, see alignment E=2.7e-29

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_0376)

Predicted SEED Role

"Branched-chain amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMY1 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Dshi_0376 inner-membrane translocator (RefSeq) (Dinoroseobacter shibae DFL-12)
MPDQLLFAMEVTLNGLMAGVMYALVALGFVLIFKASGIFNYAQGVMALFAAMTLVGIQNG
QVPFAHLINAIFGTNIHYFGWQVPALLAILLTVFVMIGFAWAVNRFVLRHLVNQEPIILF
MATIGLAYFLEGTADLMWGAEIKKLDVGLPQGLNEAIDETTFNLFGYGFFIDNLDISAAI
IATVLVSGLVIFSQYTKQGRALRAVADDHQAALSVGISLNFIWVLVWSIAGFVALVAGIM
WGAKSGVQFSLSLIALKALPVLMLGGFTSIPGAIVGGLIIGMGEQLFEFLIGQPYLGGAT
QNWFAYVLALVFLVFRPQGLFGEKIIERV