Protein Info for Dshi_0329 in Dinoroseobacter shibae DFL-12

Annotation: diguanylate cyclase/phosphodiesterase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 86 to 245 (160 residues), 88.8 bits, see alignment E=1.7e-29 PF00990: GGDEF" amino acids 86 to 242 (157 residues), 105.5 bits, see alignment E=2.5e-34 PF00563: EAL" amino acids 264 to 500 (237 residues), 218 bits, see alignment E=1.3e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0329)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LMA1 at UniProt or InterPro

Protein Sequence (529 amino acids)

>Dshi_0329 diguanylate cyclase/phosphodiesterase (RefSeq) (Dinoroseobacter shibae DFL-12)
MASARHAARAARGSGVLVSRFLDFFRSTGKQLFRDPALLAGFIPLFVALSYSTRDIRWLI
GASTLIPFLVLAIRAFDVVTSPKGGRDGLTGLPCRAALLEVLDKYFATPGASTRTAACMV
IDLDDFHSFNERWGREAADEVLRQTANRLRSAVRDNDLVVRLDADAFALYLAPSEGMTLD
STLSIADRIQRALSEPLVLHGLTAYVSASVGIALASKSPEPTAASLLVAAERAMVEARSQ
GAGALRLFSAEMQTEIRASHELAEDLAKALENGEIVAWFQPQVSTETGQVTGFEALARWD
HPSRGIVSPAEFLPAIEASGRTERLSEVMLYQGLKALVAWERGGFVIPSIGVNFAGLELR
NPHLIDKVKWELDRFGLTADRLSVEILETVITETDDDIVLRNIKALGELGCGIDLDDFGT
GHASISAIKRFKTSRIKIDRSFVTHIDKDGEQQRMVAAILTMAQQLQVESLAEGVETIGE
HSILAQLGCQHVQGFGIARPMPFEDTFAWLAEHERKRAPTPRIERQRGA