Protein Info for Dshi_0319 in Dinoroseobacter shibae DFL-12

Annotation: polar amino acid ABC transporter, inner membrane subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 32 to 55 (24 residues), see Phobius details amino acids 95 to 122 (28 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 324 to 345 (22 residues), see Phobius details amino acids 353 to 371 (19 residues), see Phobius details amino acids 381 to 402 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 93 to 155 (63 residues), 48.6 bits, see alignment E=4.6e-17 PF00528: BPD_transp_1" amino acids 237 to 406 (170 residues), 47.3 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K09970, general L-amino acid transport system permease protein (inferred from 100% identity to dsh:Dshi_0319)

Predicted SEED Role

"Glutamate/glutamine/aspartate/asparagine transport system permease protein bztB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LM91 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Dshi_0319 polar amino acid ABC transporter, inner membrane subunit (RefSeq) (Dinoroseobacter shibae DFL-12)
MTTFSDPPPASGPPNQPFNLGMLINDTRYRGYTFQFIALIALIFFFGWLVSNAIYNLAAL
GQDINFSFLGQPASYEIDQTLIPYTSTDTHMRAAFVGLLNTLLVAFLGCITATIFGVLAG
VLRLSKNWLVAKVMSVYVEIFRNIPVLIWIVIISAVMSQALPQPRAFRGEDATATMVLWD
SVAFTNRGVYIPAPVWNPGSGIVVAVFVLSIIGIFVFRRYAKNLLFNTGKLLPVGRISLA
IFFVPTLLAFFVMGRPIGLDYPELGGFNFRGGINIRGTLIALWFALALYTGAFIAENVRA
GILAVSKGQTEAAAALGMRPNRIMSLIILPQALRVIIPPVISQYLNLTKNSSLAAAIGYM
DLTGTLGGVTLNQTGRSFECVLLLMLFYLLISLSISALMNLYNNAVKLKER