Protein Info for Dshi_0250 in Dinoroseobacter shibae DFL-12

Annotation: acriflavin resistance protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 830 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 382 (22 residues), see Phobius details amino acids 389 to 411 (23 residues), see Phobius details amino acids 432 to 453 (22 residues), see Phobius details amino acids 461 to 488 (28 residues), see Phobius details amino acids 524 to 546 (23 residues), see Phobius details PF00873: ACR_tran" amino acids 7 to 819 (813 residues), 389.9 bits, see alignment E=2.3e-120 PF02355: SecD_SecF" amino acids 340 to 483 (144 residues), 24.9 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0250)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcA; Cation efflux system protein CusA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLI9 at UniProt or InterPro

Protein Sequence (830 amino acids)

>Dshi_0250 acriflavin resistance protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MRTLPFRNPRLVALALLVIIAAGLSAFLSLGRQEDPTITNLNATITTLYPGAEPSRIEAL
ISQPLEDEMRTLADMDEIKSTSATGISIISLQLDEATDPAIIEEIWSKARDGVADVARTF
PEGVQPPEFDSEGIAAVGAIFAVKPSGAAANPAVLARTAEELAERLRNVPGTKSVESWGT
PTEEVRVTLDPAATAALGLTPDAVSAAVRAADAKVQSGRLVSGSSDILLDVQGDIEALDR
LRQIVLATGPQGQVTRLGDVAEISRSPRDPAPAIALVDGQDAILLGVQANEGLQIDVWMG
WIRDEVAAFAPLLPASLTVEQIFDQAVYTADRLSEVALNMAIGVGLVVLVLLVTLGVRAA
LIVAAVLPLVSLATLASMNFIGLPIHQMSVTGLIVALGLLVDAAIVMTDDIRQRLRAGAS
RMDAVDTAVKRLFAPLLASTVTTALSFVPMILLPGGAGDFVGAIAIAVVLMLIWSLIIAL
TITPALAGWLLPEGGRGAGLPSGLAGRAFHASLRWSVRNPVRSVALALVLPAMGFASFPT
LTAQFFPGVDRDQFHIEVDLAPGAALSRTHALVEEMDALLRATPGITRVAWTLGESAPAF
YYNIVGSRQGAPGFAQELITTAAPEATADLLDPLQTTLTARFPEARILVRGLVQGPPVDA
PVEFRLEGPTLEVLRAEGERLRAILLGVEGITTVRASYEGGAPKVQVEIDEAAAQLAGLS
LADVARQLQSGLDGVTGGSLIEASEQLPVRVQLGAGTRDDLERISQMLIVPPPGNGRSSQ
TLPAFPLSAMAEISLVPSDSPIARQNGTRVNTVQAFIAPDLLPQEALVRA