Protein Info for Dshi_0243 in Dinoroseobacter shibae DFL-12

Annotation: acyltransferase 3 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 176 to 204 (29 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 264 to 287 (24 residues), see Phobius details amino acids 299 to 318 (20 residues), see Phobius details amino acids 333 to 351 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 13 to 348 (336 residues), 84.4 bits, see alignment E=3.9e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0243)

Predicted SEED Role

"acyltransferase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLI2 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Dshi_0243 acyltransferase 3 (RefSeq) (Dinoroseobacter shibae DFL-12)
MSGARPMSPGFSLWLDVLRAGAALTVLFGHMAHTRFTRGDYEVLRDWNLASDAVVVFFVL
SGVVIAYAAERDGTLGRFAFHRLTRVLSVVAPALVLTLLFDAIGQRLDLRAYQPPFFEAL
PVAEMLWRGLSFSNEWQGLSDRVRLGSNGPLWSLSYEVAFYALFAIAFYLRGFLRWVLLA
LGALLAGLPILALMPCWLLGVALWHHIQRALALPRSRAWALALGGPVTLVALKAAGLAPF
LSALTAAAVAPASHHALLGYSDEVLWNTLLALCVAAHLRGVHALCVGRTAPHRGRPARAV
RWIAQGSFSLYVLHYPVLHLLDAGLPEALPGYDLWLLALTLLACFAFAALFERRLPQQRA
RLRQLWCRLHKPRSDRPERALSG