Protein Info for Dshi_0241 in Dinoroseobacter shibae DFL-12
Annotation: large conductance mechanosensitive channel protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MSCL_DINSH: Large-conductance mechanosensitive channel (mscL) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)
KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to dsh:Dshi_0241)MetaCyc: 44% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86
Predicted SEED Role
"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A8LLI0 at UniProt or InterPro
Protein Sequence (131 amino acids)
>Dshi_0241 large conductance mechanosensitive channel protein (RefSeq) (Dinoroseobacter shibae DFL-12) MLNEFKQFIAKGNVMDMAVGIIIGAAFTAIVTSLVEDLINPIISLFTGGLDFSGLGLALT EGEEAAVFAYGNFIMAVINFLIIAWVVFLLVKMVNRIKEMAENEPEEAPAEDPGPTEKEL LMQIRDSLAKS