Protein Info for Dshi_0241 in Dinoroseobacter shibae DFL-12

Annotation: large conductance mechanosensitive channel protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 131 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 58 (17 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 1 to 129 (129 residues), 131.1 bits, see alignment E=1.3e-42 PF01741: MscL" amino acids 1 to 128 (128 residues), 154.6 bits, see alignment E=7.7e-50

Best Hits

Swiss-Prot: 100% identical to MSCL_DINSH: Large-conductance mechanosensitive channel (mscL) from Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 100% identity to dsh:Dshi_0241)

MetaCyc: 44% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLI0 at UniProt or InterPro

Protein Sequence (131 amino acids)

>Dshi_0241 large conductance mechanosensitive channel protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MLNEFKQFIAKGNVMDMAVGIIIGAAFTAIVTSLVEDLINPIISLFTGGLDFSGLGLALT
EGEEAAVFAYGNFIMAVINFLIIAWVVFLLVKMVNRIKEMAENEPEEAPAEDPGPTEKEL
LMQIRDSLAKS