Protein Info for Dshi_0240 in Dinoroseobacter shibae DFL-12

Annotation: Glutathione S-transferase domain (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF02798: GST_N" amino acids 20 to 98 (79 residues), 48.5 bits, see alignment E=2.8e-16 PF13417: GST_N_3" amino acids 23 to 100 (78 residues), 42.5 bits, see alignment E=2e-14 PF13409: GST_N_2" amino acids 29 to 98 (70 residues), 45 bits, see alignment E=4e-15 PF13410: GST_C_2" amino acids 149 to 214 (66 residues), 38.5 bits, see alignment E=3e-13 PF00043: GST_C" amino acids 154 to 219 (66 residues), 39 bits, see alignment E=2.5e-13

Best Hits

KEGG orthology group: K00799, glutathione S-transferase [EC: 2.5.1.18] (inferred from 100% identity to dsh:Dshi_0240)

Predicted SEED Role

"Glutathione S-transferase (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLH9 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Dshi_0240 Glutathione S-transferase domain (RefSeq) (Dinoroseobacter shibae DFL-12)
MSDLSRFPITARWPAENPGVIQLYSFPTPNGVKVSIALEELGLAYEPHLVTLSDTDVKSP
AFLSLNPNNKIPAIIDPDGPEGPLGLFESGAILLYLAEKTGKLAGRNAAEKAVVTQWLMF
QMGGLGPMLGQLGFFVKFAGAAIEDPRPRDRYVSEARRLLAVLEGALEGRDWIAGEYSIA
DIAIAPWLRALDFYGARELVGWADHPNLVAYLDRFLARPAVQKGLNIPARPA