Protein Info for Dshi_0239 in Dinoroseobacter shibae DFL-12

Annotation: Aspartate dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details PF03447: NAD_binding_3" amino acids 7 to 106 (100 residues), 44.8 bits, see alignment E=1.8e-15 PF01958: Asp_DH_C" amino acids 155 to 240 (86 residues), 95.5 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 44% identical to ASPD2_BORPE: Probable L-aspartate dehydrogenase 2 (nadX2) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K06989, aspartate dehydrogenase [EC: 1.4.1.21] (inferred from 100% identity to dsh:Dshi_0239)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLH8 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Dshi_0239 Aspartate dehydrogenase (RefSeq) (Dinoroseobacter shibae DFL-12)
MRLALIGLGAINRAVAAGMAGQAEMVALTRSGAEAPGVMAVSDLSALRVFAPDLVVEAAG
HGAARAYLPGLLAAGIDVLMASVGVLADPETEAAFRAAPAHGAQLTIPAGAIGGLDLLAA
LPKDSLRAVRYTGVKPPAAWAGSPAADGRDLSALDGPVTLFEGTARQAALRFPNNANVAA
TLALAGAGFDRTEARLVADPDAAGNGHAYDVISDTAEMTFSVRARPSDTPGTSATTAMSL
LRAIRNRDAAWVV