Protein Info for Dshi_0205 in Dinoroseobacter shibae DFL-12

Annotation: protein of unknown function DUF81 (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 62 (26 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 165 (26 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details PF01925: TauE" amino acids 15 to 248 (234 residues), 90.2 bits, see alignment E=8.6e-30

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to dsh:Dshi_0205)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLE4 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Dshi_0205 protein of unknown function DUF81 (RefSeq) (Dinoroseobacter shibae DFL-12)
MDLFLSLSELTLAFLVLCAVFAGVVKGAVGFAMPLILMSGLSAVVPVPVALAGLMVPSLV
MNLWQALRGGVGALSLTARTHWRLVALVLVFIALSGQLVLAVPERILSLMIGVPIALYAT
SQLLGWRLRIAPAYRRRAELGTGVIAGFFGGFSGIWGPPIVAYLVALDTPKAEQVRTQGL
LYGLASCALVLTHLRTGVANVETLTFSAMLLVPAAAGMAMGLWLQDRMDQDRFRQATLVF
LLLAGLNLVRRGIM