Protein Info for Dshi_0187 in Dinoroseobacter shibae DFL-12

Annotation: Lysine exporter protein (LYSE/YGGA) (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 61 (26 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details PF01810: LysE" amino acids 12 to 202 (191 residues), 116.9 bits, see alignment E=4e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0187)

Predicted SEED Role

"RhtB family transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLC6 at UniProt or InterPro

Protein Sequence (204 amino acids)

>Dshi_0187 Lysine exporter protein (LYSE/YGGA) (RefSeq) (Dinoroseobacter shibae DFL-12)
MITASFLLTAFVVVLAPGTGVVYTLALGLGRGRRAAGWAALGCTLGIVPHLLAVTLGLAA
VLHSSALLFNLVKFAGVAYLLWLAWGALRDGGALQVRAETTAEPGWRIARRGALINILNP
KLSIFFLALLPPFLSGNPATATAEMVLLGAVFMALTFAVFLVYGAFAAQARDWVLGSARA
MAWLNRSFAAVFALLAGRLALERA