Protein Info for Dshi_0178 in Dinoroseobacter shibae DFL-12

Annotation: aminotransferase class I and II (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 TIGR04350: putative C-S lyase" amino acids 3 to 386 (384 residues), 354.1 bits, see alignment E=4.4e-110 PF00155: Aminotran_1_2" amino acids 57 to 382 (326 residues), 144.3 bits, see alignment E=2.9e-46

Best Hits

KEGG orthology group: K14155, cystathione beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to dsh:Dshi_0178)

Predicted SEED Role

"Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LLB7 at UniProt or InterPro

Protein Sequence (390 amino acids)

>Dshi_0178 aminotransferase class I and II (RefSeq) (Dinoroseobacter shibae DFL-12)
MTFDTEIDRRNTDCIKWDKMESAFGVSPEDGLAMWIADMDFPPGPFLQEAMQGLLARADY
GYFCGLESYEDAIIGWMRDRHGWTVEREWMFTTYGLGNGIAITLNALTAPGDEVIIFSPV
YHEFAAKITKTGRVVKELPLAIVDGVYTMDFDAYAGMLSGRETMVIACSPHNPAGRVWTQ
EELTALADFCQRHDLLLISDEIHADLTFAGHTHIPMHVAAPQIADRLVMTTSASKTFNIA
GGRTGCVTIPDPDLRARFHRFFNTLDMQPNLLGVALTRAAYSPAGAAWCDALCTYLEGNA
AVFNDGVNAIPGLSAMPMQGTYLAWVDFAGTGMERPEFSERVYGTARIAATPGHTLGKGG
ESCLRFNVGMPRARVQEAVDRLADAFADLQ