Protein Info for Dshi_0150 in Dinoroseobacter shibae DFL-12

Annotation: Lytic transglycosylase catalytic (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 649 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01464: SLT" amino acids 492 to 594 (103 residues), 90.9 bits, see alignment E=2.2e-30

Best Hits

KEGG orthology group: K08309, soluble lytic murein transglycosylase [EC: 3.2.1.-] (inferred from 100% identity to dsh:Dshi_0150)

Predicted SEED Role

"Soluble lytic murein transglycosylase precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKQ6 at UniProt or InterPro

Protein Sequence (649 amino acids)

>Dshi_0150 Lytic transglycosylase catalytic (RefSeq) (Dinoroseobacter shibae DFL-12)
MAGKAIRVFFMVMAAVGLVAQAAPVRADLAEALQATRSSDWDRATRAAAALEDQAARDVV
IWTLLRARQGSWQDYRDFLARNSDWPGLPLLRARGEDAIPENAAPADVLAYFAPQAPRTG
TGARRLAAAQAATGDAEGAVETLATAWRHLNLDREEQAIFLREHFREITPQNIARLDRLL
WEGRTGDARAMLDSVPPAWQRLAEARIALRIDQPGVDGLIAAVPAALQDHPGLAYERFQW
RLRKGRIDSARELLDAQSTSAAALGDPEAWANRRRSLARDLMRDDRDREAYRLAANHFLT
EGNHYADLEWLSGFIALRKLNDPETALGHFRRFEDAVASPISLGRAGYWQGRALEALGRP
NEARAAYAMGAEHQTAFYGQLAAERAGIAPDPALAGRETYPDWAASPYARTSVFRAARAL
QQAGQRSLAERFLVHLSERLTLEEMGALADVALAWDEPHIALKIAKFAAEDGRVLHRAYH
PVTNLVPGQGLAVNRALALAIARRESEFDPAVVSPAGARGLMQLMPGTGELMAGKLGEPF
SAARLLSDPAQNVRFGAAYLDQLIEEFGENLTLIAIGYNAGPGRSRSWTERFGSPKGLDE
DAMVDWIEHVPFRETRNYIMRVTESRVIYEMRLTGRAQPFRVIERLTAR