Protein Info for Dshi_0109 in Dinoroseobacter shibae DFL-12

Annotation: Auxin Efflux Carrier (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 4 to 302 (299 residues), 123.8 bits, see alignment E=3.1e-40

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to dsh:Dshi_0109)

Predicted SEED Role

"malonate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LKL5 at UniProt or InterPro

Protein Sequence (311 amino acids)

>Dshi_0109 Auxin Efflux Carrier (RefSeq) (Dinoroseobacter shibae DFL-12)
MVAIFLQTLPFFAIIALGYGAGRTNFFSPEATAYLTKFVFYFALSAMLFRFAANLTLSDI
LDWQFVWAYLWATGVIYLLATAVALIRKLNVSEAAVEAQCAVIGNVGFLGIPMLVLLLGE
AAVGPVMLVLTVDLIVFGSLIVILITGSRDGRVSLGVLQSVGLGLLKNPMIVSISLGLAW
SALRLPIPGPMNAFLDIIGSAATPGALFAIGASLATKSAERLEVAGWLSFCKLVLHPAAV
ALAALVIFPVEDAYAAGVMIAAAALPTAGNVYILAQHYGVAPARVSATILVSTALSILTL
SAVIAWVGPMG