Protein Info for Dshi_0073 in Dinoroseobacter shibae DFL-12

Annotation: anti-sigma-factor antagonist (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 TIGR00377: anti-anti-sigma factor" amino acids 2 to 103 (102 residues), 59.7 bits, see alignment E=1.2e-20 PF01740: STAS" amino acids 10 to 106 (97 residues), 54.4 bits, see alignment E=9.6e-19 PF13466: STAS_2" amino acids 20 to 94 (75 residues), 45 bits, see alignment E=9.9e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dsh:Dshi_0073)

Predicted SEED Role

"Anti-sigma F factor antagonist (spoIIAA-2); Anti-sigma B factor antagonist RsbV"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJZ6 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Dshi_0073 anti-sigma-factor antagonist (RefSeq) (Dinoroseobacter shibae DFL-12)
MQVTTTAHGNTIVAVVHEDRIDASSAVQFKDTMQAIGRTAHGRVILDLAQVQFLDSSGLG
AVVAVMKAYAPGKRLELAGLNPVVQKVFRLTRMDKVFKVYESSAQALEAA