Protein Info for Dshi_0069 in Dinoroseobacter shibae DFL-12

Annotation: Auxin Efflux Carrier (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 62 to 84 (23 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 156 to 172 (17 residues), see Phobius details amino acids 184 to 204 (21 residues), see Phobius details amino acids 212 to 234 (23 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details PF03547: Mem_trans" amino acids 8 to 138 (131 residues), 30.7 bits, see alignment E=6.3e-12 amino acids 148 to 288 (141 residues), 45.6 bits, see alignment E=1.9e-16

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 100% identity to dsh:Dshi_0069)

Predicted SEED Role

"Auxin efflux carrier family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJZ2 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Dshi_0069 Auxin Efflux Carrier (RefSeq) (Dinoroseobacter shibae DFL-12)
MNLLLTVLNIVAPVFLLAGLGFGWVRLGWDYPLEFVTRMGMTLAVPCLIFTALMQTEIDP
AALSTVSLATLSAYIAITVVFSIYIRAVGDRQRDYLAPLTFGNTGNLGLPLALFAFGETG
LSYGVVVFAAMAIYSFTFGTWVVAGGGSLRKVIQEPMVAATLLGALFLWQGWQTPVFLTN
ALELIGQLAIPLMLITLGVAIAGLRPGRIGKALWLSVFKLVVCVGISWTIGRAFALEPVA
FGVLVLQVSTPVAVTSYLMAQKYRADADAVAGLVVVSTLVSVVALPLLLAFVI