Protein Info for Dshi_0053 in Dinoroseobacter shibae DFL-12

Annotation: HI0933 family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF01494: FAD_binding_3" amino acids 11 to 46 (36 residues), 29.1 bits, see alignment 1.5e-10 PF03486: HI0933_like" amino acids 13 to 390 (378 residues), 274.7 bits, see alignment E=3.1e-85 PF00890: FAD_binding_2" amino acids 13 to 62 (50 residues), 25.6 bits, see alignment 1.8e-09 TIGR00275: flavoprotein, HI0933 family" amino acids 15 to 390 (376 residues), 236 bits, see alignment E=6.8e-74 PF13450: NAD_binding_8" amino acids 16 to 47 (32 residues), 24.6 bits, see alignment (E = 6.2e-09) TIGR03862: flavoprotein, TIGR03862 family" amino acids 34 to 397 (364 residues), 489 bits, see alignment E=8.3e-151

Best Hits

KEGG orthology group: K07007, (no description) (inferred from 100% identity to dsh:Dshi_0053)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A8LJX6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>Dshi_0053 HI0933 family protein (RefSeq) (Dinoroseobacter shibae DFL-12)
MTGIAPLPEIETDALVVGAGPAGLMAAEQLAQAGFSVRIAEQMPSAGRKFLMAGKSGLNL
TKDEEMPAFLGAYGGAAAWLAPMLEAFGPDAVQDWARGLGQPVFTGSTGRVFPEAMKASP
LLRAWLARLAGLGVRLDTRWRCLGWQDGALRFETPAGPVRVRARAVVLGLGGASWRRLGS
DGAWAGWIGAACAPFAPANVGLRVDWSPHMARHFGAPVKGAALSSGGVVSRGEVVVSARG
LEGGGLYPLCPALREGAGLRVDLCPDLEVGALAARLARVPAKASGASRLRKGAGLSPVKQ
ALVQECARPLSRDPADLARVLKDLGVPHQGVRPLDEAISVAGGVARAALDDRLMLRDRPG
VFACGEMLDWEAPTGGYLLTGCFATGRWAGLGAVDWLRGAQAAARA