Protein Info for BT4675 in Bacteroides thetaiotaomicron VPI-5482

Annotation: heparin lyase I precursor (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF14099: Polysacc_lyase" amino acids 38 to 368 (331 residues), 95 bits, see alignment E=3e-31

Best Hits

Swiss-Prot: 68% identical to HEP1_PEDHE: Heparin lyase I from Pedobacter heparinus

KEGG orthology group: None (inferred from 100% identity to bth:BT_4675)

MetaCyc: 68% identical to heparinase I (Pedobacter heparinus)
Heparin lyase. [EC: 4.2.2.7]

Predicted SEED Role

"Heparin lyase I precursor (EC 4.2.2.7) (Heparinase I)" (EC 4.2.2.7)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YQ6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BT4675 heparin lyase I precursor (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLTAQTKNTQTLMPLTERVNVQADSARINQIIDGCWVAVGTNKPHAIQRDFTNLFDGKPS
YRFELKTEDNTLEGYAKGETKGRAEFSYCYATSDDFRGLPADVYQKAQITKTVYHHGKGA
CPQGSSRDYEFSVYIPSSLDSNVSTIFAQWHGMPDRTLVQTPQGEVKKLTVDEFVELEKT
TFFKKNVGHEKVARLDKQGNPVKDKNGKPVYKAGKPNGWLVEQGGYPPLAFGFSGGLFYI
KANSDRKWLTDKDDRCNANPGKTPVMKPLTSEYKASTIAYKLPFADFPKDCWITFRVHID
WTVYGKEAETIVKPGMLDVRMDYQEQGKKVSKHIVDNEKILIGRNDEDGYYFKFGIYRVG
DSTVPVCYNLAGYSER