Protein Info for BT4665 in Bacteroides thetaiotaomicron VPI-5482

Annotation: K+ uptake protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 90 to 107 (18 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 216 to 242 (27 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 391 to 413 (23 residues), see Phobius details amino acids 448 to 466 (19 residues), see Phobius details amino acids 476 to 495 (20 residues), see Phobius details amino acids 515 to 533 (19 residues), see Phobius details amino acids 540 to 558 (19 residues), see Phobius details amino acids 570 to 591 (22 residues), see Phobius details PF02386: TrkH" amino acids 154 to 593 (440 residues), 183.4 bits, see alignment E=3.2e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4665)

Predicted SEED Role

"Potassium uptake protein TrkH" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YR6 at UniProt or InterPro

Protein Sequence (609 amino acids)

>BT4665 K+ uptake protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIYHKFLLYQNKLLKPYVRILLGLVEALTYLASLLLIVGVVYEHGFPLSPVEVQQIQIL
YKAVWIIFLIDVTLHISLEYRNTKKQYRRLAWILSVLLYLTLVPVIFHRPEEEGAILQVW
EFLHGKFYHLILLLVFSLLNLSNGLVRLLGRRTNPSLILAVSFMAIILIGTGLLMLPRCT
VNGITWVDSLFTATSAVCVTGLVPVDVSTTFTTSGLVVIILLIQIGGLGVMTLTSFFAMF
FMGNTSIYNQLVVRDMVSSNSLGSLLSTLLYILGFTLVIEGIGMVSIWFSIHDTLGMNLE
EELAFAAFHSISAFCNAGFSTLSGNLGNSMVMTNHNWLFISVSLLIILGGIGFPILVNFK
DIVLYHLRHVWTFVRTRKLERHKMPHLYNLNTKIVLIMTFLLLLIGTLAILAFEWNASFA
GMSVADKWTQAFFNATCPRTAGFSSVDLASLSVQTLLVYLFLMWVGGGSQSTAGGVKVNA
FAVVVLNLVAVLRGSERVEVFGRELSHDSIRRSNATVVMSLGVLFLFIFILSILEPKASL
LALTFECVSALSTVGSSLNLTPQLCDASKLLVSLLMFIGRVGLITLMLGIVKQKKNTKYR
YPSDNIIIN