Protein Info for BT4609 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 99 to 117 (19 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 158 to 179 (22 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 223 to 240 (18 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 280 to 301 (22 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details PF03601: Cons_hypoth698" amino acids 45 to 311 (267 residues), 202.5 bits, see alignment E=3.9e-64

Best Hits

Swiss-Prot: 100% identical to Y4609_BACTN: UPF0324 membrane protein BT_4609 (BT_4609) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_4609)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YX1 at UniProt or InterPro

Protein Sequence (330 amino acids)

>BT4609 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MISSATKTLQTNNKTIYVAILSTLTFFLFLDYIPGLQAWSAWVTPPVALFLGLIFALTCG
QAHPKFNKKTSKYLLQYSVVGLGFGMNLQSALASGKEGMEFTVISVVGTLLIGWFIGRKI
FKIDRNTSYLISSGTAICGGSAIAAIGPVLRAKDSEMSVALGTIFILNAIALFIFPAIGH
ALDMTEHQFGTWAAIAIHDTSSVVGAGAAYGEEALKVATTIKLTRALWIIPMAFATSFIF
KSKGQKISIPWFIFFFILAMIANTYLLNGVPQLGAAINGIARKTLTITMFFIGASLSLDV
LRSVGVKPLIQGVLLWVVISLSTLAYIYFV