Protein Info for BT4597 in Bacteroides thetaiotaomicron VPI-5482

Annotation: endopeptidase Clp ATP-binding chain B (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 862 TIGR03346: ATP-dependent chaperone protein ClpB" amino acids 6 to 860 (855 residues), 1363 bits, see alignment E=0 PF02861: Clp_N" amino acids 19 to 66 (48 residues), 15 bits, see alignment 1.4e-05 amino acids 94 to 142 (49 residues), 43.6 bits, see alignment 1.6e-14 PF00004: AAA" amino acids 201 to 333 (133 residues), 51.7 bits, see alignment E=7.5e-17 amino acids 600 to 718 (119 residues), 31.5 bits, see alignment E=1.4e-10 PF17871: AAA_lid_9" amino acids 343 to 437 (95 residues), 123 bits, see alignment E=2.9e-39 PF07724: AAA_2" amino acids 594 to 764 (171 residues), 240.1 bits, see alignment E=8.2e-75 PF00158: Sigma54_activat" amino acids 598 to 699 (102 residues), 22.2 bits, see alignment E=6e-08 PF07728: AAA_5" amino acids 599 to 720 (122 residues), 48 bits, see alignment E=8.1e-16 PF10431: ClpB_D2-small" amino acids 771 to 850 (80 residues), 85.4 bits, see alignment E=1.4e-27

Best Hits

Swiss-Prot: 100% identical to CLPB_BACTN: Chaperone protein ClpB (clpB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03695, ATP-dependent Clp protease ATP-binding subunit ClpB (inferred from 100% identity to bth:BT_4597)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89YY3 at UniProt or InterPro

Protein Sequence (862 amino acids)

>BT4597 endopeptidase Clp ATP-binding chain B (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNFNNFTIKSQEAVQEAVNLVQSRGQQAIEPAHILHGVMKVGENVTNFIFQKLGMNGQQV
ALVVDKQIESLPKVSGGEPYLSRESNEVLQKATQYSKEMGDEFVSLEHILLALLTVKSTV
STILKDAGMTEKELRNAINELRKGEKVTSQSSEDNYQSLEKYAINLNEAARSGKLDPVIG
RDEEIRRVLQILSRRTKNNPILIGEPGTGKTAIVEGLAHRILRGDVPENLKNKQVYSLDM
GALVAGAKYKGEFEERLKSVVNEVKKSEGDIILFIDEIHTLVGAGKGEGAMDAANILKPA
LARGELRSIGATTLDEYQKYFEKDKALERRFQIVQVDEPDTLSTISILRGLKERYENHHH
VRIKDDAIIAAVELSSRYITDRFLPDKAIDLMDEAAAKLRMEVDSVPEELDEISRKIKQL
EIEREAIKRENDKPKLEIIGKELAELKEVEKSFKAKWQSEKTLMDKIQQNKVEIENLKFE
AEKAEREGDYGKVAEIRYGKLQALDKEIEDTQEKLRGMQGDKAMIKEEVDAEDIADVVSR
WTGIPVSKMMQSEKDKLLHLEDELHQRVIGQDEAIEAVADAVRRSRAGLQDPKRPIGSFI
FLGTTGVGKTELAKALAEFLFDDESMMTRIDMSEYQEKHSVSRLVGAPPGYVGYDEGGQL
TEAIRRKPYSVVLFDEIEKAHPDVFNILLQVLDDGRLTDNKGRVVNFKNTIIIMTSNMGS
SYIQSQMEKLSGSNKEEVIEETKKEVMNMLKKNIRPEFLNRIDETIMFLPLTETEIRQIV
LLQIKGVQKMLAENGVELEMTDAALNFLSQVGYDPEFGARPVKRAIQRYLLNDLSKKLLS
QEVDRSKAIIVDSNGDGLVFRN