Protein Info for BT4574 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 124 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details transmembrane" amino acids 7 to 22 (16 residues), see Phobius details amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 85 (18 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details PF02537: CRCB" amino acids 6 to 119 (114 residues), 109.6 bits, see alignment E=4.8e-36 TIGR00494: protein CrcB" amino acids 6 to 121 (116 residues), 98.4 bits, see alignment E=1.8e-32

Best Hits

Swiss-Prot: 100% identical to CRCB_BACTN: Putative fluoride ion transporter CrcB (crcB) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06199, CrcB protein (inferred from 100% identity to bth:BT_4574)

MetaCyc: 40% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89Z03 at UniProt or InterPro

Protein Sequence (124 amino acids)

>BT4574 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MLKTLLFIGMGSFTGGVLRYLISRYVQNFLTPSFPLGTLLVNVLGCFAIGLFYGLFERGN
LMNPNLRMFLTVGFCGGFTTFSTFMNENFQLIKDDNFFYLSLYVGLSLFVGFIMLYLGYS
LVKQ