Protein Info for BT4506 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative acetyltransferase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 PF00903: Glyoxalase" amino acids 2 to 124 (123 residues), 66.1 bits, see alignment E=1.6e-21 PF13669: Glyoxalase_4" amino acids 4 to 107 (104 residues), 40.3 bits, see alignment E=1.4e-13 PF13302: Acetyltransf_3" amino acids 148 to 285 (138 residues), 112.2 bits, see alignment E=1.3e-35 PF00583: Acetyltransf_1" amino acids 195 to 285 (91 residues), 44.1 bits, see alignment E=9.2e-15 amino acids 362 to 431 (70 residues), 41.9 bits, see alignment E=4.5e-14 PF13673: Acetyltransf_10" amino acids 367 to 436 (70 residues), 39.3 bits, see alignment E=2.5e-13 PF13508: Acetyltransf_7" amino acids 369 to 432 (64 residues), 47.7 bits, see alignment E=6.5e-16 PF08445: FR47" amino acids 380 to 434 (55 residues), 27 bits, see alignment 1.5e-09

Best Hits

KEGG orthology group: K03827, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to bth:BT_4506)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89Z71 at UniProt or InterPro

Protein Sequence (458 amino acids)

>BT4506 putative acetyltransferase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKLHHIAIWTFRLEELKDFYVRFLGGTSNEKYINPKKGFESYFISFDEGPTLELMSRADV
QNTPIEENRRGLTHLAFTFPSKEEILRFTEEMRSEGYTIVGEPRTSGDGYFESVVLDPDG
NRLECVYKKEPEAERTEAALCPNIETKRLLLRPFQENDAEAFFACCQNPNLGNNAGWAPH
KTLNESREILHGAFIGQEGIWAVTLKDTQQLIASIGIVPDPKRENPQVRMLGYWLDEPYW
GKGYMSEAVQAVLNYGFNELQLSLITANCYPHNKRSQQVLKRNGFIYEGTLHQAELTYNG
NIYDHECYYIPNIARPTEQDYDELIQLWEKSVRSTHHFLTEESIQFYKPLIRNHYLPAVE
LSIIRNSHGKIAAFMGLSDELIEMLFVHPDEQGKGYGKRLIEYAIRQKQIDKVDVNEDND
QALRFYQHLGFEIIGRDETDSMGKPYPILHLQLTDDKK