Protein Info for BT4486 in Bacteroides thetaiotaomicron VPI-5482

Annotation: voltage-gated K+ channel protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 221 to 244 (24 residues), see Phobius details PF00520: Ion_trans" amino acids 33 to 252 (220 residues), 129.1 bits, see alignment E=2.5e-41 PF08016: PKD_channel" amino acids 127 to 213 (87 residues), 25.6 bits, see alignment E=1.2e-09 PF07885: Ion_trans_2" amino acids 167 to 243 (77 residues), 54.5 bits, see alignment E=1.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4486)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89Z91 at UniProt or InterPro

Protein Sequence (292 amino acids)

>BT4486 voltage-gated K+ channel protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKLKERIHYFMNDQKLKHKLYIIIFESDTPSGKLFDVVLIGCILASVLLVIIESLKGLPS
YLTTPFVVMEYLFTAFFTFEYLTRIYCSPRPKKYIFSFFGIVDLLATLPLYIGLIFPGAR
YLLIIRAFRLIRVFRVFKLFNFLNEGERLLTALRESSKKIAVFFLFVVILVTSIGTLMYM
IEGTLPNSQFNNIPNSIYWAIVTMTTVGYGDITPVTGLGKFLSACVMLIGYTIIAVPTGI
VSASMMKDYKRRRDKECPNCHRSGHEDNAQFCKYCGHDLNPTSENEDKENVQ