Protein Info for BT4454 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF13353: Fer4_12" amino acids 13 to 81 (69 residues), 22.1 bits, see alignment E=1.7e-08 PF04055: Radical_SAM" amino acids 28 to 106 (79 residues), 54.1 bits, see alignment E=2.1e-18

Best Hits

Swiss-Prot: 100% identical to QUEE_BACTN: 7-carboxy-7-deazaguanine synthase (queE) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: None (inferred from 100% identity to bth:BT_4454)

Predicted SEED Role

"Queuosine Biosynthesis QueE Radical SAM" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZC3 at UniProt or InterPro

Protein Sequence (182 amino acids)

>BT4454 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MMRKINEIFYSLQGEGYHTGTPAVFIRFSGCNLKCSFCDTQHEAGTLMTDDEIIAEVSKY
PAVTVILTGGEPSLWIDDALIDRLHEAGKYVCIETNGTRPLPESIDWVTCSPKQGVKLGI
TRMDEVKVVYEGQDISIYELLPAEHFFLQPCSCNNTALTVDCVMRHPKWRLSLQTHKLID
IR