Protein Info for BT4450 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 224 to 242 (19 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details amino acids 310 to 330 (21 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 380 to 401 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 12 to 395 (384 residues), 121.9 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4450)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZC7 at UniProt or InterPro

Protein Sequence (411 amino acids)

>BT4450 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MTQNSIADNRMVWLDVVRCVAMLMVIGVHCIDPFYISPTMRVIPEYTHWAAIYGSLLRPS
VPLFVMMTGLLLLPVKQQPLGTFYKKRIFRVLFPFLIWSVLYSMFPWFTGLLGLPKEIIG
DFFCYTQGHESQSLIDSLKDVAMIPFNFSHKENHMWYIYLLIGLYLYMPFFSAWVERASN
KTKQIFLFIWIVSLFIPYIREYVANMLFDRSGYVFGTDTWNEFSMFYYFAGFNGYLLLGH
YLKEGGNGNALKIFWPFSGSSKDDRLTNDWSVWKTFLICAVMFAIGYYVTYTGFSTTAAN
PNATETEMELYFTFCSPNVLLMTLAMFLMLQKVVINTPVIVKALANMTQCGFGIYMVHYF
VVGPFFLLIGPSEIPIPLQVPLMAVCIFLCSWAFTALLYKLMPHKAKYIMG