Protein Info for BT4425 in Bacteroides thetaiotaomicron VPI-5482

Annotation: deoxyribose-phosphate aldolase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 TIGR00126: deoxyribose-phosphate aldolase" amino acids 18 to 228 (211 residues), 260.6 bits, see alignment E=4.6e-82 PF01791: DeoC" amino acids 22 to 227 (206 residues), 57.3 bits, see alignment E=9e-20

Best Hits

Swiss-Prot: 100% identical to DEOC_BACTN: Deoxyribose-phosphate aldolase (deoC) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01619, deoxyribose-phosphate aldolase [EC: 4.1.2.4] (inferred from 100% identity to bth:BT_4425)

Predicted SEED Role

"Deoxyribose-phosphate aldolase (EC 4.1.2.4)" in subsystem Deoxyribose and Deoxynucleoside Catabolism (EC 4.1.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.4

Use Curated BLAST to search for 4.1.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZF2 at UniProt or InterPro

Protein Sequence (238 amino acids)

>BT4425 deoxyribose-phosphate aldolase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MEKKNINEVIANLSVEQLAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVET
CVKLLEGSGVRVGAAIGFPLGQNTVECKAFETRDAIAKGATEIDTVINVRALQKGQTDIV
KKEIEDMVSICKPAGVICKVILETCYLTDEEKETVCRIAKEAGVDFVKTSTGFGTAGANV
HDVALMRRVVGPVIGVKAAGGIRDLDTALALIQVGATRIGTSSGIQIVEAYKELKKGL