Protein Info for BT4409 in Bacteroides thetaiotaomicron VPI-5482

Annotation: DNA damage-inducible protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 PF00817: IMS" amino acids 1 to 145 (145 residues), 178 bits, see alignment E=1.7e-56 PF11798: IMS_HHH" amino acids 161 to 188 (28 residues), 28.6 bits, see alignment (E = 1.7e-10) PF11799: IMS_C" amino acids 231 to 338 (108 residues), 88.7 bits, see alignment E=5.4e-29

Best Hits

Swiss-Prot: 88% identical to DPO4_BACFR: DNA polymerase IV (dinB) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 100% identity to bth:BT_4409)

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZG8 at UniProt or InterPro

Protein Sequence (353 amino acids)

>BT4409 DNA damage-inducible protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MDAFYASVEQRDHPELRGKPLAVGHAEERGVVAAASYEARRYGVRSAMSSQKAKRLCPQL
IFVSGRMDVYKSVSRQIHEIFHEYTDIIEPLSLDEAFLDVTENKKGISLAVDIAKEIKLR
IREQLNLVASAGVSYNKFLAKIASDYRKPDGLCTIHPDQALDFIAGLPIESFWGVGPVTA
KKMHLLGIHNGLQLRKCSLEMLTAHFGKVGALYYECSRGIDERPVEAVRIRKSIGCERTL
ERDISVHSSVIIELYHVAVELIERLQRKEFKGNTLTLKIKFHDFSQITRSITQSQELYTL
DRILPLAKELLKSVEYEQHPIRLIGLSVSNPKEEADEQHGVWEQLSFEFSDWE