Protein Info for BT4383 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative sugar kinase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 503 TIGR00197: YjeF family N-terminal domain" amino acids 13 to 212 (200 residues), 118.8 bits, see alignment E=2.5e-38 PF03853: YjeF_N" amino acids 26 to 191 (166 residues), 167 bits, see alignment E=5.9e-53 TIGR00196: YjeF family C-terminal domain" amino acids 231 to 499 (269 residues), 225.6 bits, see alignment E=7.9e-71 PF01256: Carb_kinase" amino acids 252 to 494 (243 residues), 202.2 bits, see alignment E=1.4e-63 PF00294: PfkB" amino acids 330 to 467 (138 residues), 31.3 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4383)

Predicted SEED Role

"NAD(P)HX epimerase / NAD(P)HX dehydratase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZJ4 at UniProt or InterPro

Protein Sequence (503 amino acids)

>BT4383 putative sugar kinase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MKIFPSSSIKKLDAYTIEHEPIASIDLMERAAQALTKAITNRWNPETPVTIFAGPGNNGG
DALAVARMMAEKGYKIEVYLFNTKGELSPDCQTNKELVEMMEEVTFHEISTQFVPPTLTP
EHLVIDGLFGSGLNKPLSGGFAAVVKYINASPAMVVSIDIPSGLMGEENTFNVKSNIIRA
DVTFSLQLPKLAFLFAENTEFVGEWELLDIQLSEEGIEETETNYEMLEIEEIRSLIKPRQ
QFAHKGNFGHALLIAGSKGMAGASVLAARACLRSGVGLLTVHAPLCNNDILQTSAPEAMV
ETDVSETCFAVPTDTDDYQAVGIGPGLGRNEETEAALIEQLEHCQTPTVLDADALNILAN
HRHTLTHLPKGSILTPHPKELERLVGKCQDSYERLMKACELAHTAKVHIILKGAYSAIIT
PEGKCYFNQTGNPGMATGGSGDVLTGVILALLAQGYPAEDAAKIGTYIHGLAGDIAQKKQ
GMIGLIASDIVTCLPTAWRLVSE