Protein Info for BT_4366 in Bacteroides thetaiotaomicron VPI-5482

Annotation: pantothenate kinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF03309: Pan_kinase" amino acids 3 to 192 (190 residues), 156.8 bits, see alignment E=3.6e-50 TIGR00671: pantothenate kinase, type III" amino acids 3 to 236 (234 residues), 122.8 bits, see alignment E=9.6e-40

Best Hits

Swiss-Prot: 100% identical to COAX_BACTN: Type III pantothenate kinase (coaX) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03525, type III pantothenate kinase [EC: 2.7.1.33] (inferred from 100% identity to bth:BT_4366)

Predicted SEED Role

"Pantothenate kinase type III, CoaX-like (EC 2.7.1.33)" in subsystem Coenzyme A Biosynthesis (EC 2.7.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.33

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZL1 at UniProt or InterPro

Protein Sequence (243 amino acids)

>BT_4366 pantothenate kinase (RefSeq) (Bacteroides thetaiotaomicron VPI-5482)
MNLIIDIGNTTAKVALFNRSEMVEVLTESNQSLDSLEALCSKYRIERGIVATVVDLNERI
LAELAALPFPLLWLNHETPLPVGNLYETPETLGYDRIAAVVGANEQFPHNDILVIDAGTC
ITYEFIDSKGQYHGGNISPGMQMRYKALHQFTGRLPLIDSNGRKLPMGRDTETAIRAGVL
KGMEYEISGYIEAMKHKYPELLVFLTGGDDFSFDSSVKSAIFADRFLVLKGLNRILNYNN
GRI