Protein Info for BT4350 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 TIGR00444: MazG family protein" amino acids 23 to 258 (236 residues), 291.3 bits, see alignment E=3.4e-91 PF03819: MazG" amino acids 32 to 105 (74 residues), 96.4 bits, see alignment E=9.8e-32 amino acids 169 to 228 (60 residues), 27.3 bits, see alignment E=3.6e-10 PF01503: PRA-PH" amino acids 161 to 218 (58 residues), 21.7 bits, see alignment E=2.2e-08

Best Hits

Swiss-Prot: 41% identical to MAZG_ECO57: Nucleoside triphosphate pyrophosphohydrolase (mazG) from Escherichia coli O157:H7

KEGG orthology group: K02428, nucleoside-triphosphate pyrophosphatase [EC: 3.6.1.19] (inferred from 100% identity to bth:BT_4350)

MetaCyc: 41% identical to nucleoside triphosphate pyrophosphohydrolase (Escherichia coli K-12 substr. MG1655)
Nucleotide diphosphatase. [EC: 3.6.1.9]

Predicted SEED Role

"Nucleoside triphosphate pyrophosphohydrolase MazG (EC 3.6.1.8)" (EC 3.6.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.9

Use Curated BLAST to search for 3.6.1.19 or 3.6.1.8 or 3.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZM7 at UniProt or InterPro

Protein Sequence (262 amino acids)

>BT4350 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIHTREEQMEAFGRFLDILDELRVKCPWDRKQTNESLRPNTIEETYELCDALMRDDKKDI
CKELGDVLLHVAFYAKIGSETGDFDIKDVCDKLCDKLIFRHPHVFGEVKAETAGQVSENW
EQLKLKEKDGNKSVLSGVPSALPSLIKAYRIQDKARNVGFDWEEREQVWDKVKEEIREFQ
VEVANMDKEKAEAEFGDVMFSLINAARLYKINPDNALELTNQKFIRRFNYLEEHTIKEGK
NLKDMSLEEMDAIWNEAKRKGL