Protein Info for BT4331 in Bacteroides thetaiotaomicron VPI-5482

Annotation: conserved hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17785: PUA_3
  • amino acids 4 to 66 (63 residues), 74 bits, E=1.6e-24
• PF02475: Met_10
  • amino acids 137 to 298 (162 residues), 26.3 bits, E=1.5e-09
• PF10672: Methyltrans_SAM
  • amino acids 183 to 345 (163 residues), 83.9 bits, E=2.8e-27
• PF05175: MTS
  • amino acids 213 to 337 (125 residues), 27.4 bits, E=6.2e-10
• PF03602: Cons_hypoth95
  • amino acids 213 to 318 (106 residues), 32 bits, E=2.4e-11

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to bth:BT_4331)

Predicted SEED Role

"LSU m5C1962 methyltransferase RlmI" in subsystem Ribosome biogenesis bacterial

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q89ZP5 at UniProt or InterPro

Protein Sequence (392 amino acids)

>BT4331 conserved hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MHKVYLKPGKEESLKRFHPWIFSGAIARFDGEPEEGEVVEVYTSKKEFIAEGHFQIGSIA
VRVLSFRQEPIDHDFWKRKLQIAYDMRCGIGIAVNPTNDTYRLVHGEGDNLPGLVIDIYA
RTAVMQAHSAGMHVDRMTIAEALSEVMGDKIENIYYKSETTLPFKADLFPENGFLKGGSS
DNIAREYGLKFHVDWLKGQKTGFFVDQRENRSLLEHYSKDRSVLNMFCYTGGFSFYAMRG
GAKLVHSVDSSAKAIDLTNKNVELNFPGDARHEAFAEDAFKYLDRMGDQYDLIILDPPAF
AKHKDALRNALQGYRKLNAKAFEKIKPGGILFTFSCSQVVTKDNFRTAVFTAAAMSGRSV
RILHQLTQPADHPVNIYHPEGEYLKGLVLYVE