Protein Info for BT4319 in Bacteroides thetaiotaomicron VPI-5482

Annotation: hypothetical protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 105 to 131 (27 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 285 to 306 (22 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 426 to 448 (23 residues), see Phobius details amino acids 454 to 473 (20 residues), see Phobius details PF18940: DUF5687" amino acids 14 to 493 (480 residues), 298 bits, see alignment E=9.9e-93

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4319)

Predicted SEED Role

"FIG00406426: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZQ7 at UniProt or InterPro

Protein Sequence (496 amino acids)

>BT4319 hypothetical protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MIFNELRKHGRLASKRHPMYEKNKVAKIFGYIGVAFWAGYLIFFGTTFAFGFADMVPNRE
PYHVMNAVALIFILALDFLLRIPFQKTPTQEVKPYLLLPVKRNRIIDFLLIRSGLSLFNL
FWLFMFVPFSFITITKYFGISGVLTYLIGIWLLIVANNYWYLLCRTLINERIWWVLLPIA
FYGGLGCLAFIPEDSPLFYFFMDLGDGYINGNILCFLGTILVIAILWLINRKIMSGLIYA
ELAKVDDTRIKHVSEYKFFERYGEVGEYMRLELKMLLRNRRCKGALRNVLLVVIAFSCLL
SFSSLYDTSTMTTFICVYNFAVFGMIILSQLMSFEGNYIDGLMSRKESIMSLLKAKYYIY
TIGEIVPFVLMIPAIVMDKVPLLGIFAWFFYTTGFIYFCFFQLAVYNKQTVALNEKVTSR
QTNSAIQMVVNFGAFGIPLILYSVLNAFLGETAAYSILFAIGLGFTLTSPLWIRNVYKRF
MKRRYENMEGFRDSRQ