Protein Info for BT4311 in Bacteroides thetaiotaomicron VPI-5482

Annotation: glucose/galactose transporter (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 31 to 49 (19 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 333 to 350 (18 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details PF07690: MFS_1" amino acids 2 to 345 (344 residues), 76.1 bits, see alignment E=1.3e-25 TIGR01272: glucose/galactose transporter WARNING" amino acids 75 to 376 (302 residues), 230.3 bits, see alignment E=2e-72

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4311)

Predicted SEED Role

"N-acetyl glucosamine transporter, NagP" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZR5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BT4311 glucose/galactose transporter (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MFFSLGFALGINSVLVPVLKGSLEISSAESYLIIAATFIPFLIFGYPAGLTIKKIGYKRT
MVLSFLMFAIAFGLFIPSASYESFPLFLLASFISGSANAYLQAAVNPYITILGPIDSAAK
RISIMGICNKLAWPIPPLFLAFLIGKEVTDITVADLFLPFYVIIAAFIALGIIAYMAPLP
EVKAVGEDDSEEAAEACPYAAKKTSIWQFPHLLLGCLALFLYVGVETVSLGTLVDYATSL
HLENAAMYAWIAPIGIVIGYICGIIFIPKYMSQATALKICSVLAIIGSVLVVLTPADISI
YFISFMALGCSLMWPALWPLAMADLGKFTKSGSSLLIMAMAGGAVIPTLFGYLKDISDIQ
KAYWICLPCFLFILYYGVAGYKIRTK