Protein Info for BT4288 in Bacteroides thetaiotaomicron VPI-5482

Annotation: ABC transporter ATP-binding protein (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 741 transmembrane" amino acids 171 to 193 (23 residues), see Phobius details amino acids 207 to 229 (23 residues), see Phobius details amino acids 287 to 306 (20 residues), see Phobius details amino acids 312 to 332 (21 residues), see Phobius details amino acids 404 to 450 (47 residues), see Phobius details PF12385: Peptidase_C70" amino acids 3 to 111 (109 residues), 30.9 bits, see alignment E=6e-11 PF03412: Peptidase_C39" amino acids 6 to 125 (120 residues), 129.3 bits, see alignment E=2.2e-41 PF00664: ABC_membrane" amino acids 174 to 442 (269 residues), 109.2 bits, see alignment E=7.6e-35 PF00005: ABC_tran" amino acids 507 to 656 (150 residues), 111.2 bits, see alignment E=1.6e-35

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 100% identity to bth:BT_4288)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZT6 at UniProt or InterPro

Protein Sequence (741 amino acids)

>BT4288 ABC transporter ATP-binding protein (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQTRQFPWEYQMDAKDCGPACIKMIAKYYGKYYSLQYLRDLCGITREGVSFLDISYAAEK
IGLRTVAVKATMENLTNRIPLPCIIHWDQHHFIVVYKTKKGKIYVSDPAKGLLSYPEEDF
KDRWYKEGEEFGMLMVLEPMANFKQIEAHERIERFKSFENLLNYFTPYKKAFGILFAIML
IATGLQAVLPFISKSVIDIGIYTQDISFIYMMLIGNIVLLLSITLSNVLRDWVLLHVSTR
VNISLISDYLIKLMKLPVTFFENKLVGDILQRAGDHERIRSFVMNNSLGMFFSIITFVVF
SIILLIYNPMIFFIFIAGSGIYVAWIFTFLSIRKKLDWEYFELNAKNQSYWVETIENVQE
IKINNYEDLKRWKWEAIQARIYRLNLKVLKINNAQSLGAQFINSMMNIAVTFYCAIAVIN
GDITFGVMISTQFIIGMLNGPVAQLVSFIQSAQYAKISFMRINEIHQLKDEDDSSPVISN
SLSLPVDKSLYLKNVSFQYSRNAPLVLKNITLQIPKGKVTAIVGDSGCGKSTLLKLLLRL
YMPSYGEICMGDMNVNNISLRNWRAKCGCVMQDGKLFNDTIQNNIVLDDANIDYEALQKA
VEVANISHEIEAMPQGYQTMIGEMGRGLSGGQRQRVLIARALYKDPDYLFLDEATNALDT
INEQKIVRALNNVFKNRTVIVVAHRLSTIRRADQIIVLKAGMIIETGNHQSLMTNKQYYY
NLIQSQYEPETNTFSTEESAD