Protein Info for BT4265 in Bacteroides thetaiotaomicron VPI-5482

Annotation: GMP synthase (glutamine-hydrolyzing) (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 5 to 191 (187 residues), 200.2 bits, E=2e-63
• PF00117: GATase
  • amino acids 7 to 186 (180 residues), 125.1 bits, E=8.3e-40
• PF07722: Peptidase_C26
  • amino acids 68 to 169 (102 residues), 33.9 bits, E=8.6e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 199 to 507 (309 residues), 470.8 bits, E=2e-145
• PF02540: NAD_synthase
  • amino acids 199 to 276 (78 residues), 32.4 bits, E=1.6e-11
• PF03054: tRNA_Me_trans
  • amino acids 215 to 248 (34 residues), 22.6 bits, see alignment (E = 2.3e-08)
• PF00958: GMP_synt_C
  • amino acids 417 to 506 (90 residues), 142 bits, E=1.5e-45

Best Hits

Swiss-Prot: 100% identical to GUAA1_BACTN: GMP synthase [glutamine-hydrolyzing] 1 (guaA1) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 100% identity to bth:BT_4265)

MetaCyc: 55% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (23/26 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

See Q89ZV6 at UniProt or InterPro

Protein Sequence (507 amino acids)

>BT4265 GMP synthase (glutamine-hydrolyzing) (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MQEKIIILDFGSQTTQLIGRRVRELDTYCEIVPYNKFPKEDPTIKGVILSGSPFSVYDKD
AFKVDLSEIRGKYPILGICYGAQFMAYTNNGKVEPAGTREYGRAHLTSFCKDNVLFKGVR
ENTQVWMSHGDTITAIPDNFKKIASTDKVDIAAYQVEGEKVWGVQFHPEVFHSEDGTQIL
RNFVVDVCGCKQDWSPASFIESTVAELKAQLGDDKVVLGLSGGVDSSVAAVLLNRAIGKN
LTCIFVDHGMLRKNEFKNVMNDYECLGLNVIGVDASEKFFAELAGVTEPERKRKIIGKGF
IDVFDVEAHKIKDVKWLAQGTIYPDCIESLSITGTVIKSHHNVGGLPEKMHLKLCEPLRL
LFKDEVRRVGRELGMPEHLITRHPFPGPGLAVRILGDITREKVRILQDADDIYIQGLRDW
GLYDQVWQAGVILLPVQSVGVMGDERTYERAVALRAVTSTDAMTADWAHLPYEFLGKISN
DIINKVKGVNRVTYDISSKPPATIEWE