Protein Info for BT4238 in Bacteroides thetaiotaomicron VPI-5482

Annotation: putative permease (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 75 to 94 (20 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 159 to 176 (18 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 281 to 298 (18 residues), see Phobius details PF00892: EamA" amino acids 2 to 144 (143 residues), 59.5 bits, see alignment E=2e-20 amino acids 158 to 295 (138 residues), 43.8 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bth:BT_4238)

Predicted SEED Role

"putative permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q89ZY3 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BT4238 putative permease (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MWLLLAFLSATLLGFYDVFKKQSLKDNAVLPVLFLNTLFSSLIFLPFILVSAFEPDLFGG
TIFNVPVAGWEQHKYIIIKSFIVLSSWIFGYFGMKHLPITIVGPINATRPVMVLVGAMLV
FGERLNLYQWIGVMLAVASFFMLSRSGKKEGIDFKHNKWILFIILAAVMGAVSGLYDKFL
MKQLNPMLVQSWYNVYQFFIMGTIIFLLWWPKRKTTTPFRWDWTIILISVFLSAADFVYF
YALSYDDSMISIVSMVRRGSVIVSFIFGALFFREKNLKSKAIDLILVLIGMIFLYLGSK