Protein Info for BT4209 in Bacteroides thetaiotaomicron VPI-5482

Annotation: orotidine 5'-phosphate decarboxylase (NCBI ptt file)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to PYRF_BACTN: Orotidine 5'-phosphate decarboxylase (pyrF) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 100% identity to bth:BT_4209)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
UMP biosynthesis II (6/6 steps found)
UMP biosynthesis III (6/6 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
UMP biosynthesis I (5/6 steps found)

KEGG Metabolic Maps

Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8A012 at UniProt or InterPro

Protein Sequence (274 amino acids)

>BT4209 orotidine 5'-phosphate decarboxylase (NCBI ptt file) (Bacteroides thetaiotaomicron VPI-5482)
MNKQQLFENIKRKKSFLCVGLDTDIKKIPEHLLKEEDPIFAFNKAIIDATADLCIAYKPN
LAFYESMGVKGWIAFEKTVKYIKENYPDQFIIADAKRGDIGNTSAMYARTFFEELEIDSV
TVAPYMGEDSVTPFLTYEGKWVILLALTSNKGSHDFQLTEDANGERLFEKVLRKSQEWAN
DERMMYVVGATQGRAFEDIRKIVPNHFLLVPGVGAQGGSLEEVCKYGMNSTCGLIVNSSR
GIIYVDKTEKFAEAARLAAQEVQVQMAEQLKAIL